DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ThrRS and mrpl39

DIOPT Version :9

Sequence 1:NP_001285868.1 Gene:ThrRS / 45784 FlyBaseID:FBgn0027081 Length:747 Species:Drosophila melanogaster
Sequence 2:NP_956209.1 Gene:mrpl39 / 334588 ZFINID:ZDB-GENE-030131-6520 Length:342 Species:Danio rerio


Alignment Length:247 Identity:61/247 - (24%)
Similarity:106/247 - (42%) Gaps:36/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 TTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAV---FWHSSAHIM 187
            :|||..||.:|:...:::.::.|:|:.|.:.:.|..:|.|.||.|.|.:.|.:   :|.|.|.::
Zfish    76 STPYSCARHLSEWHVNSSALALVDGQPWHMHKPLTRSCELTLLTFRDADPQTLNQAYWRSCAALL 140

  Fly   188 GEAMERI----YGGHLCYGP--PIENG-FYYDMHLE---------GEGISTNDYGAMEGLVKQIV 236
            |..:|..    :...|...|  |:..| |..|:.|:         .|.:.:....|:     |::
Zfish   141 GLVLESAFKDQFSVELLKTPEVPVTAGAFCCDLLLDPLLDSWKPTEENLRSLTRDAL-----QMI 200

  Fly   237 KEKQNFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDR---TTVYKCGSLIDLCRGPHVRHTGKV 298
            .....:|.||:..|..||:|..:..|...:.|.....:   .|:|:||..:.|...|.|..||..
Zfish   201 SRDLPWEPLEVSASLALEIFSQSRCKQEEVEEAAAQSQNGTVTLYRCGDHVTLSSAPLVSRTGLC 265

  Fly   299 KALKITK--NSSTYWEGKADAETLQRVYGISFPDPKQLKE--WEKLQEEAAK 346
            ...::|.  ..|.:..|     ..:|..|:|.|.......  |.||::.|.:
Zfish   266 SQFEVTSIHTLSEHTRG-----VQRRAQGLSLPVNLTAHHTVWRKLRKRAER 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ThrRSNP_001285868.1 PLN02908 79..740 CDD:178496 61/247 (25%)
TGS_ThrRS_N 109..170 CDD:133437 14/43 (33%)
tRNA_SAD 276..323 CDD:197931 12/48 (25%)
ThrRS_core 347..643 CDD:238394 61/247 (25%)
ThrRS_anticodon 643..734 CDD:238437
mrpl39NP_956209.1 TGS_ThrRS_N 66..120 CDD:133437 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.