DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ValRS and AT1G27160

DIOPT Version :9

Sequence 1:NP_001260946.1 Gene:ValRS / 45783 FlyBaseID:FBgn0027079 Length:1055 Species:Drosophila melanogaster
Sequence 2:NP_174036.1 Gene:AT1G27160 / 839605 AraportID:AT1G27160 Length:200 Species:Arabidopsis thaliana


Alignment Length:151 Identity:52/151 - (34%)
Similarity:92/151 - (60%) Gaps:7/151 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   813 YAFWLYDLCDVYLECLKPIFQSGSEEQQTAARRTLYVCLDYGLRLLSPFMPFITEELYQRLPRAN 877
            ||:|.|..|||::|.:||.| |...:::..|:..|:|||:.|||||.||||:|||||:||||.:.
plant    12 YAWWQYQFCDVFIEAIKPYF-SADTQRRIHAQDALWVCLETGLRLLHPFMPYITEELWQRLPSSQ 75

  Fly   878 PA---PSICVASYPSNTS-WRSTKIESDVEFVQKAARIIRSARSDYNLPNK--VKTEVYIVCTDS 936
            .:   .||.:..|||:.. |.:.|:|::::.|....:.:|:.|:..:|..:  .|...:.:..::
plant    76 DSERKASIMICDYPSSIEMWTNEKVETEMDMVLATVKTLRALRAAESLKRQRNEKFHAFALSGNA 140

  Fly   937 VPSEILKRYASDLATISYCSN 957
            :...|:|.:..::.|::..|:
plant   141 LTLGIVKPHELEIRTLANLSS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ValRSNP_001260946.1 PTZ00419 80..1053 CDD:240411 52/151 (34%)
ValRS_core 129..736 CDD:185677
tRNA-synt_1_2 307..436 CDD:290334
Anticodon_Ia_Val 736..873 CDD:153416 32/59 (54%)
Val_tRNA-synt_C 978..1053 CDD:287436
AT1G27160NP_174036.1 Anticodon_1 5..125 CDD:285464 47/113 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 105 1.000 Domainoid score I2213
eggNOG 1 0.900 - - E1_COG0525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001015
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.