DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PUP3

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_011020.3 Gene:PUP3 / 856830 SGDID:S000000896 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:41/225 - (18%)
Similarity:74/225 - (32%) Gaps:65/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VALKSGDCAVVATQKKVTEKNI-VPETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRY 103
            ||:...||..:|...::..::: |......:|.. ..:...:||...|..:..:..||: .|. |
Yeast    13 VAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHY-GHVFLGITGLATDVTTLNEMFRYK-TNL-Y 74

  Fly   104 KYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIA---YDNEIGPSVYKTDPAGYFSGFKA 165
            |...|..::         .:.:||            |::   |:...||         ||.|...
Yeast    75 KLKEERAIE---------PETFTQ------------LVSSSLYERRFGP---------YFVGPVV 109

  Fly   166 CSVGAKT--------------LEANSYL-------------EKKYKPNLSEEKAIQLAISCLSSV 203
            ..:.:|:              .||..::             |..|:|||..|...:.....|.:.
Yeast   110 AGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNA 174

  Fly   204 LAIDFKPN-GIEIGVVSKSDPTFRILDERE 232
            ...|.... |..:.::.|.:...|.|..|:
Yeast   175 ADRDALSGWGAVVYIIKKDEVVKRYLKMRQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 41/225 (18%)
proteasome_alpha_type_6 8..218 CDD:239723 37/209 (18%)
PUP3NP_011020.3 proteasome_beta_type_3 8..201 CDD:239728 39/220 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.