DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PRE2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:49/233 - (21%)
Similarity:82/233 - (35%) Gaps:56/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTEKN-IVPETVTHLFRITKDIGCAMTGRIAD--------------- 86
            ||:|.:.....:||...:.|..| :..:||..:..|...:...|.|..||               
Yeast    77 TTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLH 141

  Fly    87 -----SRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM--VLIAYD 144
                 .|..|..|....:|..|:|                          :..|.||  ::..|.
Yeast   142 ELREKERISVAAASKILSNLVYQY--------------------------KGAGLSMGTMICGYT 180

  Fly   145 NEIGPSVYKTDPAG-YFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDF 208
            .:.||::|..|..| ...|...| ||:....|...|:..||.:||.|.|:.|.   ..|:||...
Yeast   181 RKEGPTIYYVDSDGTRLKGDIFC-VGSGQTFAYGVLDSNYKWDLSVEDALYLG---KRSILAAAH 241

  Fly   209 KP--NGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            :.  :|..:.:...::..:......::.|...|:.|::
Yeast   242 RDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 48/230 (21%)
proteasome_alpha_type_6 8..218 CDD:239723 46/205 (22%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 46/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.