DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PRE5

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_014045.1 Gene:PRE5 / 855362 SGDID:S000004931 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:238 Identity:63/238 - (26%)
Similarity:113/238 - (47%) Gaps:18/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :|.....|||.|||:|||||.:||.|.:: ||.|:|...||:...|:..::  :......:.:..
Yeast     6 YDGDTVTFSPTGRLFQVEYALEAIKQGSV-TVGLRSNTHAVLVALKRNADE--LSSYQKKIIKCD 67

  Fly    74 KDIGCAMTGRIADSRSQV----QKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPL 134
            :.:|.::.|...|:|...    |:..|.:..|..|...|....:||    |..|..||:...||.
Yeast    68 EHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLC----DKAQKNTQSYGGRPY 128

  Fly   135 GCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKK----YKPNLSEEKAIQL 195
            |..:::|.||.. |..:.:..|:|..:.....::||::..|.:|||:.    .|.:.:.::.|:.
Yeast   129 GVGLLIIGYDKS-GAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKIDGNPDELIKA 192

  Fly   196 AISCLSSVLAID-FKPNGIEIGVVSKSDPTFRILDEREIEEHL 237
            .:..:|..|..: ...:.:.|.:|.|..| |.|.|...:.:::
Yeast   193 GVEAISQSLRDESLTVDNLSIAIVGKDTP-FTIYDGEAVAKYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 63/238 (26%)
proteasome_alpha_type_6 8..218 CDD:239723 57/217 (26%)
PRE5NP_014045.1 Ntn_hydrolase 6..217 CDD:412394 57/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.