DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PUP2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_011769.1 Gene:PUP2 / 853168 SGDID:S000003485 Length:260 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:64/242 - (26%)
Similarity:130/242 - (53%) Gaps:8/242 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.::.|||||||:||||:.:|| :...|.:.:.:.:..|:..:|:.|...:..:::..:..|.
Yeast     8 YDRGVSTFSPEGRLFQVEYSLEAI-KLGSTAIGIATKEGVVLGVEKRATSPLLESDSIEKIVEID 71

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE------MR 132
            :.|||||:|..||:||.::.||..|......|..::.|:.|.:.:.|:...:.:.|.      .|
Yeast    72 RHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEGASGEERLMSR 136

  Fly   133 PLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAI 197
            |.|.::::..:|.:.|..::..:|:|.|..:.|.::|:.:..|.:.|..::..:|:.::|..|.:
Yeast   137 PFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNEWHSSLTLKEAELLVL 201

  Fly   198 SCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            ..|..|:......|..::..::|.| .|:|.|..:..|.:.::.||:
Yeast   202 KILKQVMEEKLDENNAQLSCITKQD-GFKIYDNEKTAELIKELKEKE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 62/239 (26%)
proteasome_alpha_type_6 8..218 CDD:239723 56/214 (26%)
PUP2NP_011769.1 proteasome_alpha_type_5 8..222 CDD:239722 56/214 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.