DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and AT1G79210

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001077845.1 Gene:AT1G79210 / 844262 AraportID:AT1G79210 Length:235 Species:Arabidopsis thaliana


Alignment Length:228 Identity:73/228 - (32%)
Similarity:128/228 - (56%) Gaps:3/228 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRITKDIG 77
            :|.|||.|:|.|:|:|..|:.... |::.:|:.:..|:||:||:....:...:|..:..:|.:||
plant    10 LTTFSPSGKLVQIEHALTAVGSGQ-TSLGIKASNGVVIATEKKLPSILVDEASVQKIQHLTPNIG 73

  Fly    78 CAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIA 142
            ...:|...|.|..|:|:|.:|..:...|...:||..|.|..|.:.|.:||:..:||.|.|:::..
plant    74 TVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVSLLVAG 138

  Fly   143 YDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAID 207
            ||:: ||.:|:.||:|.:..:||.::|.....|.::|||:|..::..:.||..||..|......:
plant   139 YDDK-GPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDDAIHTAILTLKEGFEGE 202

  Fly   208 FKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240
            .....||||.:. :|..||:|...||:::|.::
plant   203 ISSKNIEIGKIG-TDKVFRVLTPAEIDDYLAEV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 73/228 (32%)
proteasome_alpha_type_6 8..218 CDD:239723 66/204 (32%)
AT1G79210NP_001077845.1 proteasome_alpha_type_2 6..232 CDD:239719 72/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.