DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PAF2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:245 Identity:73/245 - (29%)
Similarity:125/245 - (51%) Gaps:17/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTH---LF 70
            :|..:|.:||.|||:|||||.:|:.|.: ..:.|:|....|:|...|...     |..:|   :|
plant     6 YDTDVTTWSPTGRLFQVEYAMEAVKQGS-AAIGLRSRSHVVLACVNKAQS-----ELSSHQRKIF 64

  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135
            ::...||.|:.|..||.|...:..|.|:.|..:.|...:||..|...:||..||.||.:..||.|
plant    65 KVDDHIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYG 129

  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYK--PNLSEEKAIQLAIS 198
            ..:::...| |.|..:|...|:|.:..::|.::|:::..|.:|||:|::  ...|:|..|:.||.
plant   130 VGLLVGGLD-ESGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLERKFESFQESSKEDLIKDAIM 193

  Fly   199 CLSSVLAID-FKPNGIEIGVVSKSDPTFRILDEREIE---EHLTKIAEKD 244
            .:...|..: .|.:...:.|:...:| |..||:..|:   :...|:.|::
plant   194 AIRETLQGETLKSSLCTVSVLGVDEP-FHFLDQESIQKVIDTFEKVPEEE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 72/242 (30%)
proteasome_alpha_type_6 8..218 CDD:239723 65/214 (30%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 66/215 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.