DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and psma6l

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_571870.2 Gene:psma6l / 83917 ZFINID:ZDB-GENE-010502-2 Length:252 Species:Danio rerio


Alignment Length:252 Identity:156/252 - (61%)
Similarity:193/252 - (76%) Gaps:8/252 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            |||||:||||||||||||||||||||||||||:|..:|||.::..||||:.|||||::..:...|
Zfish     1 MSRGSNAGFDRHITIFSPEGRLYQVEYAFKAISQSGLTTVGIRGVDCAVLVTQKKVSDTLLDAST 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            :|::||||..|||.|||..|||||||.:||.||..::||:||::|||.||||:||::||||||||
Zfish    66 MTNMFRITPRIGCVMTGHYADSRSQVHRARIEAGEWKYKFGYDVPVDALCRRLADLSQVYTQNAE 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKP--------NL 187
            ||||||.|:||:.|.:.||.:||.||||||.||:|.|||.|..|||||||||.|.        .|
Zfish   131 MRPLGCCMMLISMDPQKGPMLYKCDPAGYFCGFRATSVGVKHTEANSYLEKKIKKMQKKKEEVEL 195

  Fly   188 SEEKAIQLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            ..:.::|:|||||||||.:|||...:|:.||:|.:|.||.|.|.|||.||..|||::
Zfish   196 DFDSSVQMAISCLSSVLCMDFKCTELEVAVVTKENPKFRTLSEVEIERHLVAIAERE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 150/243 (62%)
proteasome_alpha_type_6 8..218 CDD:239723 134/217 (62%)
psma6lNP_571870.2 PRE1 7..252 CDD:223711 151/244 (62%)
proteasome_alpha_type_6 8..226 CDD:239723 134/217 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595765
Domainoid 1 1.000 248 1.000 Domainoid score I2104
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2357
OMA 1 1.010 - - QHG53623
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002933
OrthoInspector 1 1.000 - - otm24775
orthoMCL 1 0.900 - - OOG6_102240
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.