DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PBD2

DIOPT Version :10

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001190731.1 Gene:PBD2 / 827135 AraportID:AT4G14800 Length:215 Species:Arabidopsis thaliana


Alignment Length:128 Identity:30/128 - (23%)
Similarity:54/128 - (42%) Gaps:37/128 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 MRPLGCSMVLIAYDNEIGPSVY---------KTDPA--GYFSGFKACSVGAKTLEANSYLEKKYK 184
            |.|...::::..||.|.|.|:|         |.|..  ||.|.|..           |.:::.|:
plant   110 MNPYSVNILMAGYDKEAGASLYYIDYIATLHKVDKGAFGYGSYFSL-----------STMDRHYR 163

  Fly   185 PNLSEEKAIQLAISCLSSVLAIDFKPNGIEIG---VVSKSDPTFRILDEREIEEHLTKIAEKD 244
            .::|.|:||:|...|:            :||.   |::..:...:|:|:....|:..:|:..|
plant   164 SDMSVEEAIELVDKCI------------LEIRSRLVIAPPNFVIKIVDKDGAREYGWRISTAD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 proteasome_alpha_type_6 8..218 CDD:239723 24/100 (24%)
PBD2NP_001190731.1 proteasome_beta_type_2 1..206 CDD:239727 27/118 (23%)

Return to query results.
Submit another query.