DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PAD1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:240 Identity:83/240 - (34%)
Similarity:134/240 - (55%) Gaps:8/240 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFR 71
            |.:||.||:|||:|.|:|||||.:|:.:.| ..|.::..|..|:|.:||.|.|.....:...:..
plant     2 ARYDRAITVFSPDGHLFQVEYALEAVRKGN-AAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVS 65

  Fly    72 ITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGC 136
            :...|..|..|..||:|..:.|||.|..:.|......:.|:.:.|.||.:.|.|||:..:||.|.
plant    66 LDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGL 130

  Fly   137 SMVLIAYD--NEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISC 199
            |.:::.:|  ..| |::|:|||:|.||.:||.:.|..:.....:|||.||.:..:| .::|||..
plant   131 STLIVGFDPYTRI-PALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESAGQE-TVKLAIRA 193

  Fly   200 LSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI-AEK 243
            |..|  ::.....||:.|:::.:...:.|:|.||:..:.:| |||
plant   194 LLEV--VESGGKNIEVAVMTREEGVLKQLEEEEIDIIVAEIEAEK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 81/238 (34%)
proteasome_alpha_type_6 8..218 CDD:239723 73/211 (35%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 73/210 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.