DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and AT3G26340

DIOPT Version :10

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_189265.1 Gene:AT3G26340 / 822238 AraportID:AT3G26340 Length:273 Species:Arabidopsis thaliana


Alignment Length:189 Identity:52/189 - (27%)
Similarity:83/189 - (43%) Gaps:22/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTEKN-IVPETVTHLFRITKDIGCAMTGRIAD----SRSQVQKAR-Y 96
            ||:|....:..:||...:.:... |..::|..:..|...:...|.|..||    .|:...|.| :
plant    59 TTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLH 123

  Fly    97 EAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM-VLIAYDNEIGPSVYKTDPAGYF 160
            |.||.|     .:.|....:.:|  |.:|:    .|.:|.|: .:||..:|.||.:|..|..|..
plant   124 ELANKR-----RISVSGASKLLA--NMLYS----YRGMGLSVGTMIAGWDETGPGLYYVDNEGGR 177

  Fly   161 SGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNGIEIGVVS 219
            ......|||:.:..|...|:..||.::|.|:|.:||   ..|:....|: :|...||.|
plant   178 LKGDRFSVGSGSPYAYGVLDSGYKFDMSVEEASELA---RRSIYHATFR-DGASGGVAS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 proteasome_alpha_type_6 8..218 CDD:239723 50/186 (27%)
AT3G26340NP_189265.1 proteasome_beta_type_5 58..245 CDD:239730 52/189 (28%)

Return to query results.
Submit another query.