DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and psmb13a

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:210 Identity:41/210 - (19%)
Similarity:75/210 - (35%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ALKSG---------DCAVVATQKKVTEKNIVPETV-THLFRITKDIGCAMTGRIADSRSQVQKAR 95
            |||:|         |..|:....:.|...:|.:.: ..:..|..:|.|...|..||:        
Zfish    40 ALKTGTTIAGVVFKDGVVLGADTRATSDEVVADKMCAKIHYIAPNIYCCGAGTAADT-------- 96

  Fly    96 YEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRP-------------------LGCSMVLI 141
                        |...|:|...:.    :::.|:...|                   :|.:::|.
Zfish    97 ------------EKTTDMLSSNLT----IFSMNSGRNPRVVMAVNIIQDMLFRYHGMIGANLILG 145

  Fly   142 AYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAI 206
            ..|. .|..:|...|.|........::|:..|.|...||.::|.|:..|:|..|....:.:.:..
Zfish   146 GVDC-TGSHLYTVGPYGSMDKVPYLAMGSGDLAAMGILEDRFKVNMDLEQAKALVSDAIQAGIMC 209

  Fly   207 DF-KPNGIEIGVVSK 220
            |. ..|.|::.|::|
Zfish   210 DLGSGNNIDLCVITK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 41/210 (20%)
proteasome_alpha_type_6 8..218 CDD:239723 39/206 (19%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 37/205 (18%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.