Sequence 1: | NP_524837.2 | Gene: | Prosalpha1 / 45780 | FlyBaseID: | FBgn0263121 | Length: | 244 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002792.1 | Gene: | PSMB10 / 5699 | HGNCID: | 9538 | Length: | 273 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 44/206 - (21%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 22/206 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 AQENITTVA-LKSGDCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRIADSRSQVQKAR 95
Fly 96 YEAANFRYKYGYEMPVDVLCRRIADINQVYTQN--AEMRPLGCSMVLIAYDNEIGPSVYKTDPAG 158
Fly 159 YFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNG-IEIGVVSK-- 220
Fly 221 -------SDPT 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosalpha1 | NP_524837.2 | PRE1 | 7..243 | CDD:223711 | 44/206 (21%) |
proteasome_alpha_type_6 | 8..218 | CDD:239723 | 39/189 (21%) | ||
PSMB10 | NP_002792.1 | proteasome_beta_type_7 | 40..227 | CDD:239732 | 40/194 (21%) |
Pr_beta_C | 232..267 | CDD:403609 | 1/1 (100%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |