DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PSMB10

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:206 Identity:44/206 - (21%)
Similarity:86/206 - (41%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AQENITTVA-LKSGDCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRIADSRSQVQKAR 95
            |::..||:| |...|..::....:.|..::|.: :...:..|...|.|...|..||:....:...
Human    35 ARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVA 99

  Fly    96 YEAANFRYKYGYEMPVDVLCRRIADINQVYTQN--AEMRPLGCSMVLIAYDNEIGPSVYKTDPAG 158
            .:........|.|       .|:|.:.::..|.  .....:|.|:::...| ..||.:|...|.|
Human   100 SKMELHALSTGRE-------PRVATVTRILRQTLFRYQGHVGASLIVGGVD-LTGPQLYGVHPHG 156

  Fly   159 YFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNG-IEIGVVSK-- 220
            .:|.....::|:....|.:.||.:::||::.|.|..|.:..:::.:..|....| ::..|::|  
Human   157 SYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTG 221

  Fly   221 -------SDPT 224
                   |.||
Human   222 AKLLRTLSSPT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 44/206 (21%)
proteasome_alpha_type_6 8..218 CDD:239723 39/189 (21%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 40/194 (21%)
Pr_beta_C 232..267 CDD:403609 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.