DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PSMB8

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:196 Identity:42/196 - (21%)
Similarity:76/196 - (38%) Gaps:16/196 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRI 84
            |..|:|.|      ...||:|.|.....:.|...:.:..:.:.. .|..:..|...:...|:|..
Human    63 RNVQIEMA------HGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCA 121

  Fly    85 ADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM--VLIAYDNEI 147
            ||.:...:....|...:..:.|..:.|....:.::::...|      |.:|.||  ::..:|.: 
Human   122 ADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQY------RGMGLSMGSMICGWDKK- 179

  Fly   148 GPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNG 212
            ||.:|..|..|........|.|:....|...::..|:||||.|:|..|....::.....|....|
Human   180 GPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGG 244

  Fly   213 I 213
            :
Human   245 V 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 42/196 (21%)
proteasome_alpha_type_6 8..218 CDD:239723 42/196 (21%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 38/180 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.