DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PSMB7

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_002790.1 Gene:PSMB7 / 5695 HGNCID:9544 Length:277 Species:Homo sapiens


Alignment Length:223 Identity:48/223 - (21%)
Similarity:84/223 - (37%) Gaps:52/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPE-TVTHLFRITKDIGCAMTGRIAD---- 86
            |....:.:...|...:...|..|:....:.||..:|.: ..:.:..|:.:|.|...|..||    
Human    34 YKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMT 98

  Fly    87 -----------SRSQVQKARYEAAN-------FRYKYGYEMPVDVLCRRIADINQVYTQNAEMRP 133
                       |.|..:..|...||       |||: ||                          
Human    99 TQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQ-GY-------------------------- 136

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAIS 198
            :|.::||...| ..||.:|...|.|........::|:.:|.|.:..|.|::|::.||:|..|...
Human   137 IGAALVLGGVD-VTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSE 200

  Fly   199 CLSSVLAIDF-KPNGIEIGVVSKSDPTF 225
            .:::.:..|. ..:.|::.|:||:...|
Human   201 AIAAGIFNDLGSGSNIDLCVISKNKLDF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 48/223 (22%)
proteasome_alpha_type_6 8..218 CDD:239723 44/214 (21%)
PSMB7NP_002790.1 proteasome_beta_type_7 44..232 CDD:239732 47/213 (22%)
Pr_beta_C 236..271 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.