DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PSMB1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_002784.1 Gene:PSMB1 / 5689 HGNCID:9537 Length:241 Species:Homo sapiens


Alignment Length:244 Identity:50/244 - (20%)
Similarity:95/244 - (38%) Gaps:54/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GSSAGFDRHITI------FSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEK-NI 61
            |...|.:.|...      |||        |.|     ...|.:|:...|.|:||:..:::|. :|
Human    12 GRDLGMEPHRAAGPLQLRFSP--------YVF-----NGGTILAIAGEDFAIVASDTRLSEGFSI 63

  Fly    62 VPETVTHLFRITKD--IGCAMTGRIAD--SRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADIN 122
            ........:::|..  |||  :|...|  :.:::.:||.:.  :::.....|....:...::.| 
Human    64 HTRDSPKCYKLTDKTVIGC--SGFHGDCLTLTKIIEARLKM--YKHSNNKAMTTGAIAAMLSTI- 123

  Fly   123 QVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAGYF--SGFKA-------------CSVGAKT 172
             :|::  ...|.....::...|.|...:||..||.|.:  ..|||             ..||.|.
Human   124 -LYSR--RFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKN 185

  Fly   173 LEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAID-FKPNGIEIGVVSK 220
            ::...::.      ||.::|::|......|....| :..:.:.|.:|:|
Human   186 MQNVEHVP------LSLDRAMRLVKDVFISAAERDVYTGDALRICIVTK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 49/241 (20%)
proteasome_alpha_type_6 8..218 CDD:239723 47/236 (20%)
PSMB1NP_002784.1 proteasome_beta_type_1 30..241 CDD:239726 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.