DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and PSMA3

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_002779.1 Gene:PSMA3 / 5684 HGNCID:9532 Length:255 Species:Homo sapiens


Alignment Length:258 Identity:77/258 - (29%)
Similarity:123/258 - (47%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRI 72
            |:|...:.|||:||::|||||.||: :.:.|.:.::..|..|...:|.|..|.....:...||.:
Human     7 GYDLSASTFSPDGRVFQVEYAMKAV-ENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNV 70

  Fly    73 TKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCS 137
            .:.:|.|:.|.:||:||....||.||:|||..:||.:|:..|..|:|.....||..:.:||.|||
Human    71 DRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCS 135

  Fly   138 MVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLS-------------- 188
            .:|.:|....|..:|..||:|...|:..|::|.....|.:.:||.....::              
Human   136 FMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYI 200

  Fly   189 -----EEKAIQLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTK--IAEKD 244
                 ::||.:|.:|.:..:      .|| ...:|.|        |.||..|...|  :.|:|
Human   201 VHDEVKDKAFELELSWVGEL------TNG-RHEIVPK--------DIREEAEKYAKESLKEED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 75/255 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 68/228 (30%)
PSMA3NP_002779.1 proteasome_alpha_type_3 5..217 CDD:239720 66/210 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.