DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and psma6b

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001002589.1 Gene:psma6b / 436862 ZFINID:ZDB-GENE-040718-329 Length:246 Species:Danio rerio


Alignment Length:246 Identity:163/246 - (66%)
Similarity:203/246 - (82%) Gaps:2/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            ||||||||||||||||||||||||||||||||.|..:|:||::..|||:|.|||||.:|.:...|
Zfish     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKLLDSST 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            ||||||||::|||.|:|..||||||||:|||||||::||||||:|||:||:|||||:||||||||
Zfish    66 VTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAE 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAI 193
            ||||||.|::|..|.|:||.|||.|||||:.||||.:.|.|..||.|:||||.|..|  :.|:|:
Zfish   131 MRPLGCCMIVIGLDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQAV 195

  Fly   194 QLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            :.||:||::||:|||||:.:||||::..||.||||.|.|::.||..::|:|
Zfish   196 ETAITCLTTVLSIDFKPSELEIGVITAEDPKFRILSESEVDTHLVSLSERD 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 155/237 (65%)
proteasome_alpha_type_6 8..218 CDD:239723 143/211 (68%)
psma6bNP_001002589.1 PRE1 7..245 CDD:223711 155/237 (65%)
proteasome_alpha_type_6 8..220 CDD:239723 143/211 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595764
Domainoid 1 1.000 248 1.000 Domainoid score I2104
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2085
Inparanoid 1 1.050 337 1.000 Inparanoid score I2357
OMA 1 1.010 - - QHG53623
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 1 1.000 - - FOG0002933
OrthoInspector 1 1.000 - - otm24775
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1008
SonicParanoid 1 1.000 - - X1933
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.