DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:241 Identity:66/241 - (27%)
Similarity:118/241 - (48%) Gaps:7/241 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLF 70
            |:.:.|.:|||||:|.|.|||||.:|: ::..|.|.::..:|.|:..:|....:.....||..:.
  Fly     2 SSRYGRALTIFSPDGHLLQVEYAQEAV-RKGSTAVGVRGANCVVLGVEKSSVSEMQEDRTVRKIS 65

  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135
            .:.:.:..|..|..||:|..:.:.:.|..:.|..:..::.::.:.|.:|.:.|.|||....||.|
  Fly    66 MLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLKQKYTQCNGRRPFG 130

  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEK--AIQLAIS 198
            .|.::...|.:....::.|:|:|.|..:||.:.|........:.||.|..:....|  ||:||:.
  Fly   131 ISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAYSDHEVTTKCDAIKLAMR 195

  Fly   199 CLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            .|..|  .......:|:.|:....| .::||...|.| :.||.:.:
  Fly   196 ALLEV--TQMSQMRLEVAVLENGKP-MKMLDSVVISE-IVKIVQNE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 65/237 (27%)
proteasome_alpha_type_6 8..218 CDD:239723 57/211 (27%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 65/238 (27%)
proteasome_alpha_type_7 5..213 CDD:239724 57/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441021
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.