DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and psma5

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_991271.1 Gene:psma5 / 403011 ZFINID:ZDB-GENE-040625-96 Length:241 Species:Danio rerio


Alignment Length:237 Identity:70/237 - (29%)
Similarity:130/237 - (54%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.:..|||||||:|||||.:|| :...|.:.:::.:...:|.:|::|...:.|.::..:..|.
Zfish     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEID 71

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQ-----NAEMRP 133
            ..|||||:|.|||:::.:.|||.|..|..:.|...|.|:.:.:.::::...:.:     .|..||
Zfish    72 SHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRP 136

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAIS 198
            .|.:::....| |.||.:|..||:|.|....|.::|:.:..|.|.|::.|..:::.:.||:.:::
Zfish   137 FGVALLFGGVD-EKGPQLYHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKDAIKSSLT 200

  Fly   199 CLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240
            .|..|:........||:..| :...||.:..:.|:|:.:..|
Zfish   201 ILKQVMEEKLNATNIELATV-EPGKTFHMYTKEELEDVIKDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 70/237 (30%)
proteasome_alpha_type_6 8..218 CDD:239723 64/213 (30%)
psma5NP_991271.1 proteasome_alpha_type_5 8..220 CDD:239722 64/213 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.