DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosbeta6

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524115.1 Gene:Prosbeta6 / 39855 FlyBaseID:FBgn0002284 Length:235 Species:Drosophila melanogaster


Alignment Length:255 Identity:60/255 - (23%)
Similarity:99/255 - (38%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSAGFDRHITIFSPEGRLYQV----EYAFKAIAQENITTVALKSGDCAVVATQKKVTE-KNIVPE 64
            |..||::.     |:   |||    ...|........:.||:...|.||:|...:::. .||...
  Fly     2 SRLGFEQF-----PD---YQVPGMKHPDFSPYESNGGSIVAIAGDDFAVIAADTRLSSGYNIHSR 58

  Fly    65 TVTHLFRITK-----DIGC-----AMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIA 119
            |.:.||:::.     ..||     ::||.|     :|:...||..:.|         .:....:|
  Fly    59 TQSKLFKLSPQTVLGSAGCWADTLSLTGSI-----KVRMQSYEHTHLR---------TMTTEAVA 109

  Fly   120 DINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAG------YFSGFKACSVGAKTLE---- 174
            .:..:...|....|...|.:|...|||....||..||.|      |.:|..|.::....|:    
  Fly   110 QMLSIAMYNRRFFPYYVSNILAGIDNEGKGVVYSYDPIGHCEKATYRAGGTAGTLLQPVLDNQIG 174

  Fly   175 -ANSYLEKKYKPNLSEEKAIQLAISCLSSVLAID-FKPNGIEIGVVSKSDPTFRILDERE 232
             .|..||...|..|::|:|:.:|.....|....| :..:.:.|.:::|.....|.|..|:
  Fly   175 HKNMNLEDADKIKLTKERAVSVASDTFISAAERDIYTGDSVLINIITKDGIEVRTLTLRQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 59/253 (23%)
proteasome_alpha_type_6 8..218 CDD:239723 55/236 (23%)
Prosbeta6NP_524115.1 proteasome_beta_type_1 22..235 CDD:239726 53/227 (23%)
PRE1 24..225 CDD:223711 49/214 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441051
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.