DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:241 Identity:50/241 - (20%)
Similarity:95/241 - (39%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGFD-----RHITI----FSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIV 62
            |||:     |:.|:    |.|           ....:...|.|.:...|..::....:.||..||
  Fly    12 AGFNFDNCKRNATLLNRGFKP-----------PTTTKTGTTIVGIIYKDGVILGADTRATEGPIV 65

  Fly    63 PE-TVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYT 126
            .: ....:..:.|:|.|...|..||:                    ||..|::..:: :::::.|
  Fly    66 SDKNCAKIHYLAKNIYCCGAGTAADT--------------------EMTTDLISSQL-ELHRLQT 109

  Fly   127 QNAEMRPLGCS----MVLIAYDNEI------------GPSVYKTDPAGYFSGFKACSVGAKTLEA 175
             :.|:|.:..:    .:|..|...|            ||.:|...|.|........::|:.:|.|
  Fly   110 -DREVRVVAANTMLKQMLFRYQGHISAALVLGGVDKTGPHIYSIHPHGSSDKLPYATMGSGSLAA 173

  Fly   176 NSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDF-KPNGIEIGVVSK 220
            .:..|.::||:||||:..:|....::|.:..|. ..:.|::.|:.|
  Fly   174 MTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVIRK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 50/241 (21%)
proteasome_alpha_type_6 8..218 CDD:239723 47/236 (20%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 42/200 (21%)
proteasome_beta_type_7 42..228 CDD:239732 42/200 (21%)
Pr_beta_C 232..264 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.