DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosalpha4T2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001286844.1 Gene:Prosalpha4T2 / 37910 FlyBaseID:FBgn0017556 Length:252 Species:Drosophila melanogaster


Alignment Length:241 Identity:68/241 - (28%)
Similarity:120/241 - (49%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.:||:||:|.|.|||||.:|: :...|.:.|::.:..|:..:|:..........|..:..:.
  Fly     5 YDRAVTIYSPDGHLLQVEYAQEAV-RRGSTVMGLRTNNAIVIGVEKRSVGDLQEERMVRKICMLD 68

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM 138
            ..:....:|..||:|..|.:|:.||.:.|..:.....|:.:.|.||.:.|.|||:...||.|.|.
  Fly    69 DHVVMTFSGLTADARILVSRAQMEAQSHRLNFEKPTTVEYITRYIAQLKQNYTQSNGRRPFGLSC 133

  Fly   139 VLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLS---EEKAIQLAISCL 200
            ::..:|.:..|.:::|||:|.|..::|.:.|..:.....|:||.....|:   |..||:..:..|
  Fly   134 LVGGFDEDGTPHLFQTDPSGIFYEWRANTTGRSSQPVRDYMEKHADEILTIADEAAAIKHIVRTL 198

  Fly   201 SSVLAIDFKPNGIEIGVVSKSDPTFRILD-----------EREIEE 235
            .||.:::.  ..:|:.|:....| .|::|           .||||:
  Fly   199 VSVSSLNH--TQMEVAVLKYRQP-LRMIDHQVLADLERTVRREIED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 68/241 (28%)
proteasome_alpha_type_6 8..218 CDD:239723 60/211 (28%)
Prosalpha4T2NP_001286844.1 arc_protsome_A 5..215 CDD:163366 61/212 (29%)
Ntn_hydrolase 5..214 CDD:294319 60/211 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.