DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosbeta5R1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_611776.1 Gene:Prosbeta5R1 / 37690 FlyBaseID:FBgn0034842 Length:315 Species:Drosophila melanogaster


Alignment Length:183 Identity:44/183 - (24%)
Similarity:78/183 - (42%) Gaps:18/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALK-SGDCAVVATQKKVTEKNIVPETVTHLFRITKDIGCAMTGRIAD----SRSQVQKARYE 97
            ||:..| .|...:.|..:..:.:.|..:|:..:..:...:...:.|..||    .|...::.|..
  Fly    73 TTLGFKYRGGVILCADSRATSGQYIGSQTMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECRLH 137

  Fly    98 AANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG--CSMVLIAYDNEIGPSVYKTDPAGYF 160
            ...:|.:    |.||...|.|.:|      :.|.:.:|  ..|:|..:|:| ||.:...|..|..
  Fly   138 QLRYRKR----MTVDTAARIICNI------STEYKGMGLVMGMMLAGFDDE-GPKLIYVDSEGMR 191

  Fly   161 SGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNGI 213
            |..:..|||:.:..|...|:..|:.:||:::|..||...:....:.|....||
  Fly   192 SHGQVFSVGSGSPYALGVLDTGYRYDLSDQEAYDLARRAIYHATSKDAYSGGI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 44/183 (24%)
proteasome_alpha_type_6 8..218 CDD:239723 44/183 (24%)
Prosbeta5R1NP_611776.1 PTZ00488 39..272 CDD:185666 44/183 (24%)
proteasome_beta_type_5 72..259 CDD:239730 44/183 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.