DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psma8

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001102354.1 Gene:Psma8 / 364814 RGDID:1311659 Length:250 Species:Rattus norvegicus


Alignment Length:241 Identity:80/241 - (33%)
Similarity:133/241 - (55%) Gaps:11/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.||:|||:|.|:|||||.:|: ::..|.|.::..:..|:..:||...|.....||..:..:.
  Rat     5 YDRAITVFSPDGHLFQVEYAQEAV-KKGSTAVGIRGTNIVVLGVEKKSVAKLQDERTVRKICALD 68

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDV--LCRRIADINQVYTQNAEMRPLGC 136
            ..:..|..|..||:|..:.:||.|..:  :|...|.||.|  :.|.||.:.|.|||:...||.|.
  Rat    69 DHVCMAFAGLTADARVVISRARVECQS--HKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGI 131

  Fly   137 SMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNL--SEEKAIQLAISC 199
            |.:::.:|::..|.:|:|||:|.:..:||.::|........:|||.|..:.  ::.:||:|||..
  Rat   132 SALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAISNDNEAIKLAIKA 196

  Fly   200 LSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI-AEKD 244
            |..|:....|  .||:.::.:..| .::...:|||..:|:| .|||
  Rat   197 LLEVVQSGGK--NIELAIIRRDQP-LKMFSAKEIELEVTEIEREKD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 77/238 (32%)
proteasome_alpha_type_6 8..218 CDD:239723 71/212 (33%)
Psma8NP_001102354.1 PRK03996 5..234 CDD:235192 76/234 (32%)
proteasome_alpha_type_7 5..213 CDD:239724 71/212 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.