DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosalpha7

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster


Alignment Length:244 Identity:76/244 - (31%)
Similarity:132/244 - (54%) Gaps:12/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRI 72
            |:|...:.|||:||::|::||.||: :::.|.:.::..|..|:|.:|.:|.|...|:....:|.|
  Fly     7 GYDLSASQFSPDGRVFQIDYASKAV-EKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTI 70

  Fly    73 TKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCS 137
            .|:||.|:.|.:||.......||.||||:|.::...:|:..||.|:|.....||..:.:||.|.|
  Fly    71 EKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLS 135

  Fly   138 MVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSS 202
            ::|.::|...||.:||.:|:|...|:.||:.|.....|.:.:| |.|.::..::.::.|...:..
  Fly   136 IILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEME-KLKMDMRTDELVESAGEIIYK 199

  Fly   203 V----LAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTK---IAEKD 244
            |    ...||:   .|:|:|.:......:::..|:.|...|   .|.||
  Fly   200 VHDELKDKDFR---FEMGLVGRVTGGLHLINPSELTEKARKAGDAANKD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 74/241 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 69/213 (32%)
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 69/213 (32%)
PRE1 6..231 CDD:223711 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.