DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:197 Identity:35/197 - (17%)
Similarity:74/197 - (37%) Gaps:28/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTEKNIV-PETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANF 101
            |.:.:|..|..::|.........|| .|....:.:::..:..:..|...|:....:......|.:
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67

  Fly   102 RYKYGYEM----PVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTD------P 156
            :.:.||::    ......:.:|:..:..|      |....|.:..||...||.:...|      |
  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRT------PYQVFMFVAGYDPNAGPELTFIDYLANALP 126

  Fly   157 AGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSV---LAIDFKPNGIEIGVV 218
            ..|      ...|...:.|:|..::.:.||:::.:|..:...|::.:   |.::.|  ...:.||
  Fly   127 VNY------AGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLK--NFTVAVV 183

  Fly   219 SK 220
            .|
  Fly   184 DK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 35/197 (18%)
proteasome_alpha_type_6 8..218 CDD:239723 32/193 (17%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 35/197 (18%)
proteasome_beta_type_2 1..192 CDD:239727 35/197 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441027
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.