DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosbeta4R2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001259950.1 Gene:Prosbeta4R2 / 33451 FlyBaseID:FBgn0031443 Length:210 Species:Drosophila melanogaster


Alignment Length:175 Identity:34/175 - (19%)
Similarity:71/175 - (40%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTEKNIV--PETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAAN 100
            |.:.:|..|..::|:. .:..|::|  .:..:.:.|:: |..  |...:.|....:|...:.:.|
  Fly     5 TILGIKGPDFVMLASD-TMQAKSLVFMKDDQSKIHRLS-DFN--MMATVGDGGDTIQFTDFISKN 65

  Fly   101 ---FRYKYGYEMPVDVLC----RRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAG 158
               ::..:||.:......    :.:||..:..|:      ...:|:|..||...||.::..|..|
  Fly    66 LHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTR------YQVAMLLAGYDAVEGPDLHYIDSYG 124

  Fly   159 YFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSV 203
            ..........|..::...|.|::.:...||:|.|..|...|:..:
  Fly   125 AAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEI 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 34/175 (19%)
proteasome_alpha_type_6 8..218 CDD:239723 34/175 (19%)
Prosbeta4R2NP_001259950.1 PRE1 1..194 CDD:223711 34/175 (19%)
proteasome_beta_type_2 3..194 CDD:239727 34/175 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441026
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.