DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:91 Identity:21/91 - (23%)
Similarity:41/91 - (45%) Gaps:5/91 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLS 201
            |:::..||...||.::..|..|.....:....||........||:.|||::..:.|..:...|:.
  Fly   101 SLLVGGYDLTSGPELHYIDYLGNSVPVRYGGHGAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVI 165

  Fly   202 SV---LAIDFKPNGIEIGVVSKSDPT 224
            .:   ..|:.:  .|::.::||:..|
  Fly   166 ELYKRFVINLR--NIDLFLISKNGIT 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 21/91 (23%)
proteasome_alpha_type_6 8..218 CDD:239723 18/83 (22%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 21/91 (23%)
proteasome_beta_type_2 1..193 CDD:239727 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.