DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and psma4

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_999862.1 Gene:psma4 / 326687 ZFINID:ZDB-GENE-040426-1932 Length:261 Species:Danio rerio


Alignment Length:251 Identity:73/251 - (29%)
Similarity:133/251 - (52%) Gaps:14/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETV--TH 68
            |..:|...|||||||||||||||.:||.... |.:.:.:.|..::|.:::...| ::.|..  ..
Zfish     2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAG-TCLGILANDGVLLAAERRNIHK-LLDEVFFSEK 64

  Fly    69 LFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRP 133
            ::::.:|:.|::.|..:|:.....:.|..|..:..:|...:|.:.|...:.||.|.|||....||
Zfish    65 IYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRP 129

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKP-NLSEEKAIQLAI 197
            .|.|::.:.:|...|..:|::||:|.:.|:||..:|..:..|.|.|::.||. .::...|:.||:
Zfish   130 FGVSLLYMGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLSAALALAV 194

  Fly   198 SCLSSVLAID-FKPNGIEIGVVSKSD--PTFRILDEREIEEHLTK------IAEKD 244
            ..|:..:.:. .....:||..:::.:  ...::|.::|:||.:.|      .||||
Zfish   195 KVLNKTMDVSKLSAEKVEIATLTRENGKTKIKVLKQKEVEELIKKHEAEEAKAEKD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 69/247 (28%)
proteasome_alpha_type_6 8..218 CDD:239723 63/213 (30%)
psma4NP_999862.1 PTZ00246 1..237 CDD:173491 68/236 (29%)
proteasome_alpha_type_4 3..216 CDD:239721 63/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.