DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psma5

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058978.2 Gene:Psma5 / 29672 RGDID:61848 Length:241 Species:Rattus norvegicus


Alignment Length:237 Identity:69/237 - (29%)
Similarity:128/237 - (54%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRIT 73
            :||.:..|||||||:|||||.:|| :...|.:.:::.:...:|.:|::|...:.|.::..:..|.
  Rat     8 YDRGVNTFSPEGRLFQVEYAIEAI-KLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEID 71

  Fly    74 KDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQ-----NAEMRP 133
            ..|||||:|.|||:::.:.|||.|..|..:.|...|.|:.:.:.::::...:.:     .|..||
  Rat    72 AHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRP 136

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAIS 198
            .|.:::....| |.||.::..||:|.|....|.::|:.:..|.|.|::.|..:::.::||:.::.
  Rat   137 FGVALLFGGVD-EKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLI 200

  Fly   199 CLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKI 240
            .|..|:........||:..|.... .|.:..:.|:||.:..|
  Rat   201 ILKQVMEEKLNATNIELATVQPGQ-NFHMFTKEELEEVIKDI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 69/237 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 63/213 (30%)
Psma5NP_058978.2 proteasome_alpha_type_5 8..220 CDD:239722 63/213 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.