DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psma4

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058977.1 Gene:Psma4 / 29671 RGDID:61846 Length:261 Species:Rattus norvegicus


Alignment Length:245 Identity:71/245 - (28%)
Similarity:133/245 - (54%) Gaps:8/245 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETV--TH 68
            |..:|...|||||||||||||||.:||.... |.:.:.:.|..::|.:::...| ::.|..  ..
  Rat     2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGHAG-TCLGILANDGVLLAAERRNIHK-LLDEVFFSEK 64

  Fly    69 LFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRP 133
            ::::.:|:.|::.|..:|:.....:.|..|..:..:|...:|.:.|...:.||.|.|||....||
  Rat    65 IYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRP 129

  Fly   134 LGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKP-NLSEEKAIQLAI 197
            .|.|::.|.:|...|..:|::||:|.:.|:||..:|..:..|.|.|::.||. .::.:.|:.||:
  Rat   130 FGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAV 194

  Fly   198 SCLSSVLAID-FKPNGIEIGVVSKSD--PTFRILDEREIEEHLTKIAEKD 244
            ..|:..:.:. .....:||..:::.:  ...|:|.::|:|:.:.|..|::
  Rat   195 KVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 69/241 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 64/213 (30%)
Psma4NP_058977.1 proteasome_alpha_type_4 3..216 CDD:239721 64/214 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.