DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psma3

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058976.1 Gene:Psma3 / 29670 RGDID:61844 Length:255 Species:Rattus norvegicus


Alignment Length:258 Identity:75/258 - (29%)
Similarity:121/258 - (46%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTHLFRI 72
            |:|...:.|||:||::|||||.||: :.:.|.:.::..|..|...:|.|..|.....:...||.:
  Rat     7 GYDLSASTFSPDGRVFQVEYAMKAV-ENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNV 70

  Fly    73 TKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCS 137
            .:.:|.|:.|.:||:||....||.||:|||..:||.:|:..|..|:|.....||..:.:||.|||
  Rat    71 DRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCS 135

  Fly   138 MVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLS-------------- 188
            .:|.:|....|..:|..||:|...|:..|::|.....|.:.:||.....::              
  Rat   136 FMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYI 200

  Fly   189 -----EEKAIQLAISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTK--IAEKD 244
                 ::||.:|.:|.               :|.::|........|.||..|...|  :.|:|
  Rat   201 VHDEVKDKAFELELSW---------------VGELTKGRHEIVPKDVREEAEKYAKESLKEED 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 73/255 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 67/228 (29%)
Psma3NP_058976.1 proteasome_alpha_type_3 5..217 CDD:239720 66/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.