DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psma1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_058974.1 Gene:Psma1 / 29668 RGDID:61841 Length:263 Species:Rattus norvegicus


Alignment Length:246 Identity:71/246 - (28%)
Similarity:123/246 - (50%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTH---LF 70
            :|..:|::||:||::|:|||.:|:.|.: .||.|||...||:...|:...     |...|   :.
  Rat     6 YDNDVTVWSPQGRIHQIEYAMEAVKQGS-ATVGLKSKTHAVLVALKRAQS-----ELAAHQKKIL 64

  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135
            .:...||.::.|..||:|......|.|..:.|:.:...:||..|...|....|:.||....||.|
  Rat    65 HVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYG 129

  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSE------EKAIQ 194
            ..:::..|| ::||.|::|.|:..:...:|.|:||::..|.:|||:    ::||      ::.::
  Rat   130 VGLLIAGYD-DMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLER----HMSEFMQCNLDELVK 189

  Fly   195 LAISCLSSVLAI--DFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEK 243
            ..:..|...|..  |.....:.||:|.| |..|.|.|:.::...|..:.|:
  Rat   190 HGLRALRETLPAEQDLTTKNVSIGIVGK-DLEFTIYDDDDVSPFLDGLEER 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 70/244 (29%)
proteasome_alpha_type_6 8..218 CDD:239723 63/219 (29%)
Psma1NP_058974.1 proteasome_alpha_type_1 6..216 CDD:239718 63/220 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..263 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.