DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and CG30382

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001163078.1 Gene:CG30382 / 246582 FlyBaseID:FBgn0050382 Length:244 Species:Drosophila melanogaster


Alignment Length:244 Identity:244/244 - (100%)
Similarity:244/244 - (100%) Gaps:0/244 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPET 65

  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 VTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAE 130

  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQL 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 MRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQL 195

  Fly   196 AISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244
            |||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 AISCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 235/235 (100%)
proteasome_alpha_type_6 8..218 CDD:239723 209/209 (100%)
CG30382NP_001163078.1 PRE1 7..243 CDD:223711 235/235 (100%)
proteasome_alpha_type_6 8..218 CDD:239723 209/209 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470122
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 1 1.000 - - H2085
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102240
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.