DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psmb1

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_035315.1 Gene:Psmb1 / 19170 MGIID:104884 Length:240 Species:Mus musculus


Alignment Length:224 Identity:45/224 - (20%)
Similarity:92/224 - (41%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEK-NIVPETVTHLFRITKD--IGCA 79
            |.|....|:..|...|....|.:|:...|.::||:..:::|. :|........:::|..  ||| 
Mouse    18 PHGSAGPVQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGC- 81

  Fly    80 MTGRIAD--SRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIA 142
             :|...|  :.:::.:||.:.  :::.....|....:...::.|  :|::  ...|.....::..
Mouse    82 -SGFHGDCLTLTKIIEARLKM--YKHSNNKAMTTGAIAAMLSTI--LYSR--RFFPYYVYNIIGG 139

  Fly   143 YDNEIGPSVYKTDPAGYF--SGFKA-------------CSVGAKTLEANSYLEKKYKPNLSEEKA 192
            .|.|...:||..||.|.:  ..|||             ..||.|.::...::.      |:.::|
Mouse   140 LDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVP------LTLDRA 198

  Fly   193 IQLAISCLSSVLAID-FKPNGIEIGVVSK 220
            ::|......|....| :..:.:.|.:|:|
Mouse   199 MRLVKDVFISAAERDVYTGDALRICIVTK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 45/224 (20%)
proteasome_alpha_type_6 8..218 CDD:239723 43/220 (20%)
Psmb1NP_035315.1 PRE1 18..240 CDD:223711 45/224 (20%)
proteasome_beta_type_1 29..240 CDD:239726 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.