DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and Psma2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_032970.2 Gene:Psma2 / 19166 MGIID:104885 Length:234 Species:Mus musculus


Alignment Length:236 Identity:78/236 - (33%)
Similarity:130/236 - (55%) Gaps:8/236 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIV--PETVTHLF 70
            |:...:|.|||.|:|.|:|||..|:| ....:|.:|:.:..|:||:||  :|:|:  ..:|..:.
Mouse     5 GYSFSLTTFSPSGKLVQIEYALAAVA-GGAPSVGIKAANGVVLATEKK--QKSILYDERSVHKVE 66

  Fly    71 RITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLG 135
            .|||.||...:|...|.|..|.:||..|..:...|...:|...|.:|:|.:.|.|||:..:||.|
Mouse    67 PITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFG 131

  Fly   136 CSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCL 200
            .|:::..: ||..|.::::||:|.:..:||.::|...:...::|||:|..:|..|.||..||..|
Mouse   132 VSLLICGW-NEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTL 195

  Fly   201 SSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIA 241
            ..........:.||:|:.:::.  ||.|...|:.::|..||
Mouse   196 KESFEGQMTEDNIEVGICNEAG--FRRLTPTEVRDYLAAIA 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 78/236 (33%)
proteasome_alpha_type_6 8..218 CDD:239723 71/211 (34%)
Psma2NP_032970.2 proteasome_alpha_type_2 6..231 CDD:239719 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.