DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and pas-2

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_505750.1 Gene:pas-2 / 179493 WormBaseID:WBGene00003923 Length:231 Species:Caenorhabditis elegans


Alignment Length:235 Identity:73/235 - (31%)
Similarity:125/235 - (53%) Gaps:9/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNIVPETVTH 68
            |...||.  :|.|||.|:|.|:|||..|: :....:|.|::.|..|:||:   ...:::.:....
 Worm     2 GDHYGFS--LTTFSPSGKLMQIEYALNAV-KNGQPSVGLRAKDGVVLATE---NVGSVLTDDQPK 60

  Fly    69 LFRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRP 133
            :.:|:|.|||..:|...|.|..|:|||..|..:...||.|||...|...||.:.|.|||:..:||
 Worm    61 VEQISKHIGCVYSGMGPDFRILVKKARKIAMEYEMMYGEEMPTIQLVTDIAAVMQEYTQSGGVRP 125

  Fly   134 LGCSMVLIAYDNEIG-PSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAI 197
            .|.|:::..:|...| |.:::.||:|.:..:||.::|...:.|.::|||::...|..:..|..|:
 Worm   126 FGASLLIAGWDKNPGRPLLFQCDPSGAYFAWKATALGKNDVNAKTFLEKRFSEALELDDGIHTAL 190

  Fly   198 SCLSSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHL 237
            ..|.....:....|.:|:.|.:.:.  |..|.::::.:||
 Worm   191 LTLRESFDVGMNENNVEVAVCNSTG--FHRLTKQQVHDHL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 72/232 (31%)
proteasome_alpha_type_6 8..218 CDD:239723 67/210 (32%)
pas-2NP_505750.1 proteasome_alpha_type_2 5..229 CDD:239719 72/232 (31%)
PRK03996 10..228 CDD:235192 68/223 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.