DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and pbs-5

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:175 Identity:43/175 - (24%)
Similarity:78/175 - (44%) Gaps:11/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TVALKSGDCAVVATQKKVTE-KNIVPETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAANFR 102
            |.|.|.|  .:||...:.:. :.|..::|..:..|...:...|.|..||.:...:........:.
 Worm    76 TPADKGG--IIVAVDSRASSGEYISSKSVMKILDIGDRMVATMAGGAADCQFWTRIVAKYCTLYE 138

  Fly   103 YKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACS 167
            .:....:.|....:..|  |.:|....:...:| ||| ..||.: ||.::|.|..|.....|.||
 Worm   139 LREKTSITVSAASKYFA--NTLYGYRGQGLSVG-SMV-AGYDKK-GPQIFKVDSEGDRCQLKVCS 198

  Fly   168 VGAKTLEANSYLEKKYKPNLSEEKAIQLAISCLSSVLAIDFKPNG 212
            ||:.:|.|...|:..|||.:::::|.:|.   |.:::...::.:|
 Worm   199 VGSGSLNAYGILDNHYKPKMTDDEARKLG---LRAIMHATYRDSG 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 43/175 (25%)
proteasome_alpha_type_6 8..218 CDD:239723 43/175 (25%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 43/175 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.