DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and AT4G15165

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001190735.1 Gene:AT4G15165 / 10723067 AraportID:AT4G15165 Length:208 Species:Arabidopsis thaliana


Alignment Length:200 Identity:56/200 - (28%)
Similarity:95/200 - (47%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVVATQKKVTEKNI-VPETVTHL 69
            |..:|...|||||||||||||||.:||.... :.:.:.:.|..|:..:||||.|.: ...::..:
plant     2 SRRYDSRTTIFSPEGRLYQVEYAMEAIGNAG-SAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKM 65

  Fly    70 FRITKDIGCAMTGRIADSRSQVQKARYEAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPL 134
            ::|...:.||:.|.::|:...:..||.:|..:...:|:::                         
plant    66 YKIDDHVACAVAGIMSDANILINTARVQAQRWDRNHGFQL------------------------- 105

  Fly   135 GCSMVLIAYDNEIGPSVYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISC 199
                             |.:||:|.:.|::|.:|||....|.|.|::.||.:.:.|:.:||||..
plant   106 -----------------YMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDDATREEVVQLAIKV 153

  Fly   200 LSSVL 204
            ||..:
plant   154 LSKTM 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 55/198 (28%)
proteasome_alpha_type_6 8..218 CDD:239723 55/197 (28%)
AT4G15165NP_001190735.1 Ntn_hydrolase 3..173 CDD:382028 55/198 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.