DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha1 and psmb5

DIOPT Version :9

Sequence 1:NP_524837.2 Gene:Prosalpha1 / 45780 FlyBaseID:FBgn0263121 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_002941560.1 Gene:psmb5 / 100379732 XenbaseID:XB-GENE-975048 Length:257 Species:Xenopus tropicalis


Alignment Length:167 Identity:44/167 - (26%)
Similarity:70/167 - (41%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TTVALKSGDCAVVATQKKVTE-KNIVPETVTHLFRITKDIGCAMTGRIAD----SRSQVQKAR-Y 96
            ||:|.|.....:||...:.|. ..|..:||..:..|...:...|.|..||    .|...::.| |
 Frog    55 TTLAFKFRHGVIVAVDSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIY 119

  Fly    97 EAANFRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSM--VLIAYDNEIGPSVYKTDPAGY 159
            |..|..     .:.|....:.:|  |.||    :.:.:|.||  ::..:|.. ||.:|..|..|.
 Frog   120 ELRNKE-----RISVAAASKLLA--NMVY----QYKGMGLSMGTMICGWDKR-GPGLYYVDSEGN 172

  Fly   160 FSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLA 196
            .......|||:.::.|...|::.|...:..|:|.:||
 Frog   173 RVSGSVFSVGSGSMYAYGVLDRGYNYEMEVEEAQELA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha1NP_524837.2 PRE1 7..243 CDD:223711 44/167 (26%)
proteasome_alpha_type_6 8..218 CDD:239723 44/167 (26%)
psmb5XP_002941560.1 proteasome_beta_type_5 54..241 CDD:239730 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.