DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and AT4G01350

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_192044.2 Gene:AT4G01350 / 828015 AraportID:AT4G01350 Length:652 Species:Arabidopsis thaliana


Alignment Length:319 Identity:68/319 - (21%)
Similarity:100/319 - (31%) Gaps:96/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SSHGVTELDSLEDSCSGLMIKDGDKLCKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSP 199
            |||....|....||..|        .|.||..:|:.|         |..|.......|...|..|
plant    64 SSHHQHPLLLTNDSIDG--------PCDLCGQKLLPP---------CYSCSTCEFKVDLTCAMKP 111

  Fly   200 NSCSSSSFDGSEHQ--NRLSAVF-------IECPVCKQETPLGPKGIKALPCD-YIVTNILDLSN 254
                  |....||.  :..|.||       :.|.:|| ::..|| ....|.|| |...|.:.||.
plant   112 ------SPPAIEHPLCHHHSLVFLKKREEKVSCELCK-DSIAGP-SYSCLECDVYFHVNCIQLSK 168

  Fly   255 -----LESEH---------------IVCTSC--KSKEEAISRCNDCANFLCNGCDNAHKYMRCFE 297
                 ..|.|               ..|..|  |..|..:..|:.|....|.||.         :
plant   169 EVNHPCHSAHPLKLIPFESLTDDAETTCLLCGKKPAENMLYHCSVCNFTSCLGCT---------K 224

  Fly   298 NHHVVRIEDLTKNVHDKLIIHKPVFCPQHV----SENLKYYCFTCQVPTCNDCLLSDHKGSDHHY 358
            |..::.||.:..:.|..::..:.:.|...:    .|...|.|..|...|...|:           
plant   225 NPPLLVIEHIKTHKHPLILFPRRIPCICDICGKKCEFAVYVCPQCDFVTARGCI----------- 278

  Fly   359 ETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKC 417
                        ||...::  :.:.|:......:||:..::....|:.| .|.:.||.|
plant   279 ------------DLARVIN--INRHDHRIYLTHHLGTGYSKCGVCHENV-NQYKGAYSC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 19/80 (24%)
BBOX 321..360 CDD:237988 7/42 (17%)
BBC 369..494 CDD:128778 11/49 (22%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
AT4G01350NP_192044.2 C1_3 391..420 CDD:284959
C1_2 551..581 CDD:281148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.