DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and ftr55

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:XP_021323885.1 Gene:ftr55 / 569296 ZFINID:ZDB-GENE-070424-161 Length:198 Species:Danio rerio


Alignment Length:206 Identity:42/206 - (20%)
Similarity:64/206 - (31%) Gaps:60/206 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 ADLEETLSDTLKKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKR-------------- 420
            |::.|.|..|..:.|...........|:.|...|.....:|:.:|.:.:||              
Zfish     3 AEVVEQLKKTRLQTDVPASRLKEKQRAIKERTEQKQKAIKQLREAIESHKRSTQTTVEDCTRVFT 67

  Fly   421 ------------MLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKLQHA-AQFGQRAVDKA 472
                        :.|.|:||....:.|...        ||:.::..:..|:.. .:..|.:....
Zfish    68 ELICFIKRSCSELTEQIRDQERAAVSRAEG--------LMERLKQEIDHLKRTNTELEQLSHTDC 124

  Fly   473 NSIEFLLLKPIISAQCLNLMEQTPKCDINYQLQFD--------------SKPEMFEQFAREMFGK 523
            |.|.||        |.|..:...|  |....|.||              .|.:| |.|.:|...|
Zfish   125 NHIRFL--------QNLKSLSAVP--DFTDNLTFDFFFSFNGVRKSVCHLKQKM-EAFCKEERKK 178

  Fly   524 FQTDHIDSSPK 534
            ....|.|..||
Zfish   179 ISVTHSDIVPK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325
BBOX 321..360 CDD:237988
BBC 369..494 CDD:128778 27/150 (18%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
ftr55XP_021323885.1 PRK15347 2..>120 CDD:333124 21/124 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR25462
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.