DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and ftr79

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:XP_697299.3 Gene:ftr79 / 568850 ZFINID:ZDB-GENE-060126-4 Length:663 Species:Danio rerio


Alignment Length:432 Identity:95/432 - (21%)
Similarity:155/432 - (35%) Gaps:100/432 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LMIKDGDKL-CKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSS--SSFDGSEHQ 213
            :::::.|:. |.:|...|..|..:.|.|.:|..|:....:||   .:.|..|..  .:|......
Zfish    32 IILENNDQYSCSVCLDLLKDPVTIPCGHSYCMSCINECWNKD---QNGPYKCPQCRQTFSSKPPL 93

  Fly   214 NRLSAVFIEC--PVCKQETPLGPKGIKALPCDYIVTNILDLSNLESEHIVCTSCKSKEEAISRCN 276
            || |.|..|.  .:..:|:|..|.|...:.||:.|          .|.|         :|:..|.
Zfish    94 NR-STVLAEIMDNLRAKESPQSPAGPGEIACDFCV----------GESI---------KAVKSCL 138

  Fly   277 DCANFLCNGCDNAHKYMRCFENHHVVRIEDL-TKNVHDKLIIHKPVFCPQHVSENLKYYCFTCQV 340
            :|....|......|..:...:.|.:|:...: ..:.||||               |:.||.|.|.
Zfish   139 ECRASYCELHVQPHYNVPALKKHVLVKASTIPVCSKHDKL---------------LEVYCRTDQT 188

  Fly   341 PTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDA-GSNLGSALTELQSQH 404
            ..|..||:.||||.|      ||.....|.:.|..|.||..|......| ...|.....::.|..
Zfish   189 CVCAHCLMDDHKGHD------TVPSTTERKEKEMQLKDTQTKVKQTIQAKEKELQKMKKDIMSHS 247

  Fly   405 DTVRQQIEDAYKCY--------KR---MLESIKDQMLNEL--GRLHSDRELKIMDLMQSMENTMG 456
            |:.:..:|::...:        ||   |.|.||.|...:|  ||...::....:..::..|..:.
Zfish   248 DSTKAAVENSKNVFTDLVKLIEKRSSEMTEKIKAQEKADLDQGRKLQEKVKVEITHLKKREGVLE 312

  Fly   457 KLQHAAQFGQRAVDKANSIEFL-----------------LLKPIISAQCLNLMEQTPKCDINYQL 504
            .|.|.          .|:|.||                 ..||..|...:|.:    .|.:..||
Zfish   313 TLSHT----------DNNIHFLQNYESVLCSGSDGFPSHSFKPGCSYTDVNKL----LCQLKEQL 363

  Fly   505 QFDSKPEMFEQFAREMFGKFQTDHIDSSPKKLGMTQQLQQQQ 546
            :     .:|.|...|.|.|.......::|..:.:..:::.::
Zfish   364 E-----AVFNQKINETFQKVSDLTTKNNPSCINVGDRVRVKE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 19/76 (25%)
BBOX 321..360 CDD:237988 13/38 (34%)
BBC 369..494 CDD:128778 32/155 (21%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
ftr79XP_697299.3 RING_Ubox 41..84 CDD:327409 12/45 (27%)
zf-B_box 167..206 CDD:306989 18/59 (31%)
OmpH 210..>309 CDD:332039 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR25462
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.