DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and ftr66

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:XP_690320.2 Gene:ftr66 / 561829 ZFINID:ZDB-GENE-070912-661 Length:545 Species:Danio rerio


Alignment Length:331 Identity:78/331 - (23%)
Similarity:136/331 - (41%) Gaps:65/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 CKLCSLRLVMPRILSCLHVFCEDCLQAVVS-KDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECP 224
            |.:|...|..|..:.|.|.:|..|:....: ||.:...|...|:.:              |...|
Zfish    12 CSICLDLLKDPVAIPCGHSYCMLCINDYWNQKDHLGIFSCPQCAQT--------------FTPRP 62

  Fly   225 VCKQETPLGPKGIK----ALPCDYIVTNILDLSNLESEHIVCTSCKS-KEEAISRCNDCANFLCN 284
            |..:.|.|.....|    .||.:.|.:|.:      ...:.|..|.| |::|:..|..|....|.
Zfish    63 VLNRNTMLADVVNKLRKLELPDEQIYSNFM------PGDVACDFCTSIKQKAVKSCLVCLASYCQ 121

  Fly   285 GCDNAHKYMRCFENHHVVRIEDLTKNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLS 349
            ....||......:.|.::   :...|:.:|:       ||:| .:.|:.||.|.|...|..|::.
Zfish   122 NHLEAHYKSPALKKHKLI---EALANIQEKI-------CPRH-DKYLEIYCRTDQQCICLLCVMD 175

  Fly   350 DHKGSD-------------------HHYETATVAEQAVRADLEETLSDTLK-KADYCNDAGSNLG 394
            :|||.|                   ..|:....:::....:|::.: |.|| .|....:.|..:.
Zfish   176 EHKGHDVVPGDVESTKKQKELGMTRQKYKLKIHSKEKDLMELKQAV-DALKISAQTAIENGEKIF 239

  Fly   395 SALTE-LQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIMDLMQSMENTMGKL 458
            |.|.: ::.:....|..|.|..|..:.||::: :|.:|||.:  .||||::  |::| |:.:..|
Zfish   240 SELMQSIERRQCKFRDLISDQEKAAESMLQTL-EQEINELKQ--RDRELEM--LLKS-EDQVHVL 298

  Fly   459 QHAAQF 464
            |:.:.|
Zfish   299 QNCSSF 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 15/69 (22%)
BBOX 321..360 CDD:237988 15/57 (26%)
BBC 369..494 CDD:128778 28/98 (29%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
ftr66XP_690320.2 RING 12..54 CDD:302633 11/41 (27%)
zf-B_box 146..184 CDD:279037 15/45 (33%)
Phasin <218..290 CDD:298582 22/77 (29%)
SPRY_PRY_SNTX 364..542 CDD:294002
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR25462
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.