DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and NHLRC3

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_001012772.1 Gene:NHLRC3 / 387921 HGNCID:33751 Length:347 Species:Homo sapiens


Alignment Length:344 Identity:69/344 - (20%)
Similarity:118/344 - (34%) Gaps:127/344 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   968 FQFGVAGKEEGQLW-----YPRK----------VAVMHNNGKFVVCDRGNERSRMQIFSKCGHFM 1017
            |.|.|:.:.|..|:     :|:.          |||...||...:..||:...::.:|::.|:|:
Human    33 FTFAVSWRTEKILYRLDVGWPKHPEYFTGTTFCVAVDSLNGLVYIGQRGDNIPKILVFTEDGYFL 97

  Fly  1018 RKIAIRY-IDIVAGL--AVTAKGHIVAVDSVSP-----TVFVISEEGELVR-------------- 1060
            |  |..| :|...|:  |.|.....|.:..|..     ||...|..|:||:              
Human    98 R--AWNYTVDTPHGIFAASTLYEQSVWITDVGSGFFGHTVKKYSSFGDLVQVLGTPGKKGTSLNP 160

  Fly  1061 -WFDCSDYMREPSDIAIRD-NDFYVCDFKG----HCVAVFQD---------DGTFLYRIGNEKVT 1110
             .||      .|:::.:.| .|.|:.|..|    ..:.:.||         :||     |..|..
Human   161 LQFD------NPAELYVEDTGDIYIVDGDGGLNNRLIKLSQDFMILWLHGENGT-----GPAKFN 214

  Fly  1111 CFPNGIDISNAGDVLIGDSHGNRFHV-------------ACYSREGALQSEFECPHVKVSRCCGL 1162
             .|:.:.:.:||.|.:.|....|..|             .|::.||.               ..:
Human   215 -IPHSVTLDSAGRVWVADRGNKRIQVFDKDTGEWLGAWNNCFTEEGP---------------SSV 263

  Fly  1163 KITSEGYVVTLAKNN-------------------------------HHVLVLN--TLYVHXLQIK 1194
            :.|.:|..:.:|:.|                               .|:|.::  |..|: .:|.
Human   264 RFTPDGKYLIVAQLNLSRLSVVAAPPVGSIGECSVISTIQLADQVLPHLLEVDRKTGAVYVAEIG 328

  Fly  1195 ARNNRPSVDMNKYNYKYSS 1213
            |:..:..|.:|.|...:.|
Human   329 AKQVQKYVPLNSYVPSFGS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325
BBOX 321..360 CDD:237988
BBC 369..494 CDD:128778
NHL_brat_like 913..1186 CDD:271329 61/315 (19%)
NHL repeat 936..972 CDD:271329 2/3 (67%)
NHL repeat 983..1025 CDD:271329 14/52 (27%)
NHL repeat 1028..1064 CDD:271329 12/57 (21%)
NHL repeat 1068..1107 CDD:271329 11/52 (21%)
NHL repeat 1112..1151 CDD:271329 10/51 (20%)
NHL repeat 1157..1183 CDD:271329 6/56 (11%)
NHLRC3NP_001012772.1 NHL 1 47..93 9/45 (20%)
NHL 66..336 CDD:302697 59/298 (20%)
NHL repeat 107..153 CDD:271320 11/45 (24%)
NHL 2 150..196 8/51 (16%)
NHL repeat 166..205 CDD:271320 8/38 (21%)
NHL 3 200..243 11/48 (23%)
NHL repeat 213..250 CDD:271320 7/37 (19%)
NHL repeat 258..295 CDD:271320 6/51 (12%)
NHL 4 294..338 7/43 (16%)
NHL repeat 308..335 CDD:271320 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.