DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and Trim45

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_001099923.1 Gene:Trim45 / 295323 RGDID:1309168 Length:579 Species:Rattus norvegicus


Alignment Length:431 Identity:116/431 - (26%)
Similarity:197/431 - (45%) Gaps:50/431 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LDSLED-SCSGLMIKDGDKLCKLCSLRLVMPRILSCLHVFCEDCLQ-----AVV-----SKDTMS 195
            ::.|:| |.||   ..|...|..|.....:||:|.|||..|..||:     :||     ..||.|
  Rat    12 VNKLQDASASG---SSGKTHCPSCLRLFKVPRLLPCLHTVCTSCLERLDPFSVVDIRGGDSDTSS 73

  Fly   196 ASS----PNSCSSSSFDGSEHQNRLSAVFIECPVCKQETPLGPKGIKALPCDYIVTNILDLSNL- 255
            ..|    |.|||.....|           |.||||..:..|...|:|||..|::..|.:.|.:| 
  Rat    74 EGSIFQEPKSCSLKPQIG-----------ILCPVCDAQVDLPLGGVKALTVDHLAMNDVMLESLH 127

  Fly   256 -ESEHIVCTSCKSKEEAISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLTKNVHDKLIIHK 319
             |.:.:||..| |..|...||..|...||:.|..||:..:...:|.:|.::||.....    :.|
  Rat   128 GEGQGLVCDLC-SDREVEKRCQTCKANLCHFCCQAHRRQKKTTDHTMVDLKDLKGYSR----VGK 187

  Fly   320 PVFCPQHVSENLKYYCFTCQVPTCNDCLLSDHKGSDHHYE-TATVAEQ---AVRADLEETLSDTL 380
            |:.||.|.:|.|:.:|..|..|.|.||::.:|:  :|.|: |:.|..:   :||    |.|.||.
  Rat   188 PILCPSHPAEELRLFCELCDRPVCRDCVVGEHR--EHPYDFTSNVIHKHGDSVR----ELLRDTQ 246

  Fly   381 KKADYCNDAGSNLGSALTELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDRELKIM 445
            ...:...||.:.:.|:...||.:.:.|...:....:.|.|.:|..:|::|.:|..:...:|..:.
  Rat   247 PHVEALEDALAQIKSSNNALQERVEAVAADVRTFSEGYIRAIEEHRDKLLRQLDDIRVQKENSLQ 311

  Fly   446 DLMQSMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQC--LNLMEQTPKCDINYQLQFDS 508
            .....:|..:..::...:|.:..:...:.:|.|:.|.::..:.  ||.:|.:.:..:|:::.| |
  Rat   312 LQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILVTKGVVVERLRKLNKVEYSARPGVNHKICF-S 375

  Fly   509 KPEMFEQFAREMFGKFQTDHIDSSPKKLGMTQQLQQQQQQQ 549
            ..|.......|::|...|..:|.:...| ..:.|.:.:::|
  Rat   376 PQEKARCQGYEVYGAINTQEVDPAQCVL-QGEDLHRAREKQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 27/85 (32%)
BBOX 321..360 CDD:237988 14/39 (36%)
BBC 369..494 CDD:128778 25/126 (20%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
Trim45NP_001099923.1 BBOX 189..226 CDD:237988 14/38 (37%)
iSH2_PI3K_IA_R 237..357 CDD:304922 24/123 (20%)
Filamin 396..492 CDD:279024 4/21 (19%)
IG_FLMN 398..496 CDD:214720 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR25462
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.