DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mei-P26 and Rnf152

DIOPT Version :9

Sequence 1:	NP_001356936.1	Gene:	mei-P26 / 45775	FlyBaseID:	FBgn0026206	Length:	1310	Species:	Drosophila melanogaster
Sequence 2:	NP_001099775.1	Gene:	Rnf152 / 293561	RGDID:	1305251	Length:	203	Species:	Rattus norvegicus

Alignment Length:	104	Identity:	28/104 - (26%)
Similarity:	39/104 - (37%)	Gaps:	33/104 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   161 CKLC----SLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFI 221
            |::|    |.|. .|::|.|.|..|..|||                          |.|.|...:
  Rat    12 CQICFNYYSPRR-RPKLLDCKHTCCSVCLQ--------------------------QMRTSQKDV 49

  Fly   222 ECPVCKQETPLGPK-GIKALPCDYIVTNILDLSNLESEH 259
            .||.|:..|.|.|. .:..||.|..|..::.:.: .|||
  Rat    50 RCPWCRGITKLPPGFSVSQLPDDPEVLAVIAIPH-TSEH 87

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mei-P26	NP_001356936.1	RING_Ubox	158..230	CDD:354325	18/72 (25%)
		BBOX	321..360	CDD:237988
		BBC	369..494	CDD:128778
		NHL_brat_like	913..1186	CDD:271329
		NHL repeat	936..972	CDD:271329
		NHL repeat	983..1025	CDD:271329
		NHL repeat	1028..1064	CDD:271329
		NHL repeat	1068..1107	CDD:271329
		NHL repeat	1112..1151	CDD:271329
		NHL repeat	1157..1183	CDD:271329
Rnf152	NP_001099775.1	RING-HC_RNF152	11..55	CDD:319462	17/69 (25%)
		Necessary for interaction with RRAGA. /evidence=ECO:0000250\|UniProtKB:Q8N8N0	106..165
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	140..159
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D489543at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010