DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and Nhlrc3

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_766089.1 Gene:Nhlrc3 / 212114 MGIID:2444520 Length:347 Species:Mus musculus


Alignment Length:291 Identity:70/291 - (24%)
Similarity:98/291 - (33%) Gaps:103/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   797 NVVAQVPGGSAVTGAAVVGASHAHQQQSQAVMPASAVTP-TQPITLADILSGDQ----RALNNLQ 856
            |.....|.|..|:|                       || .|.:.:.|:.||..    :..|:|.
Mouse   101 NYTVDTPHGMFVSG-----------------------TPFEQSVWITDVGSGPYGHTVKKYNSLG 142

  Fly   857 ALAKL---------GLNNNDFCMPPATSPSLQSLNP------------IVGGVEDMGLNNFHAVA 900
            .|.::         |||            .||..||            ||.|  |.||||     
Mouse   143 DLVQVLGTPGKKGTGLN------------PLQFDNPAELYVDDTGEMYIVDG--DGGLNN----- 188

  Fly   901 APGTTSVVTGRNKATPMQIRCKFGSLGTAKGQFNSPHGFCLGVDEEIIVADTNNHRIEVFDK--- 962
                 .:|........:.:|   |..||...:||.||...|.....:.|||..|.|::||||   
Mouse   189 -----RLVKLSQDFMILWLR---GENGTGPAKFNIPHSVTLDAVGRVWVADRGNKRLQVFDKDTG 245

  Fly   963 --MGALKFQFGVAGKEEGQLWYPRKVAVMHNNGKFVVCDRGNERSRMQIF-----SKCGHFMRKI 1020
              :||....|    .|||    |..|. ...:||:::..:.| .||:.:.     ...|......
Mouse   246 EWLGAWDNCF----TEEG----PSAVR-FTPDGKYLIVAQLN-LSRLSVLLAPPSGSIGDCSVVS 300

  Fly  1021 AIRYIDIVAGLAVTAKGHIVAVDSVSPTVFV 1051
            .|:..|.|.       .|::.||..:..|:|
Mouse   301 TIQLADQVL-------PHLLEVDRKTGAVYV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325
BBOX 321..360 CDD:237988
BBC 369..494 CDD:128778
NHL_brat_like 913..1186 CDD:271329 40/149 (27%)
NHL repeat 936..972 CDD:271329 15/40 (38%)
NHL repeat 983..1025 CDD:271329 9/46 (20%)
NHL repeat 1028..1064 CDD:271329 6/24 (25%)
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
Nhlrc3NP_766089.1 NHL 1 47..93
NHL 66..336 CDD:302697 70/291 (24%)
YncE <66..308 CDD:225926 64/266 (24%)
NHL repeat 107..153 CDD:271320 13/68 (19%)
NHL 2 150..196 16/69 (23%)
NHL repeat 166..205 CDD:271320 11/53 (21%)
NHL 3 200..243 17/45 (38%)
NHL repeat 213..250 CDD:271320 14/36 (39%)
NHL repeat 258..299 CDD:271320 10/46 (22%)
NHL 4 294..338 9/38 (24%)
NHL repeat 308..335 CDD:271320 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.